Recombinant Human UBR4/p600 protein (ab153218)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human UBR4/p600 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRL DRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ -
Amino acids
94 to 190 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab153218 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
This product was previously labelled as UBR4.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 600 kDa retinoblastoma protein associated factor
- 600 kDa retinoblastoma protein-associated factor
- E3 ubiquitin-protein ligase UBR4
see all -
Function
E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Regulates integrin-mediated signaling. May play a role in activation of FAK in response to cell-matrix interactions. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Belongs to the UBR4 family.
Contains 1 UBR-type zinc finger. -
Cellular localization
Membrane. Cytoplasm. Cytoplasm > cytoskeleton. Nucleus. Concentrates at the leading edge of membrane structures involved in actin motility. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab153218 has not yet been referenced specifically in any publications.