Overview

  • Product name

    Recombinant Human UBXD8 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDR LNEQEGVPSVFNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIM LPFRFTYYTILDIFRFALRFIRPDPRSRVTDPVGDIVSFMHSFEEKYGRA HPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDSDEFCRNTLCAPEVIS LINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLE GLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS LRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECL PPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEK FQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEVLFVQDLTDE
    • Amino acids

      1 to 445
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ETEA

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI462440
    • expressed in T cells and eosinophils in atopic dermatitis
    • faf2
    • FAF2_HUMAN
    • Fas associated factor family member 2
    • FAS-associated factor 2
    • KIAA0887
    • Protein ETEA
    • Protein expressed in T cells and eosinophils in atopic dermatitis
    • Protein expressed in T-cells and eosinophils in atopic dermatitis
    • UBX domain containing 8
    • UBX domain protein 3B
    • UBX domain-containing protein 3B
    • UBX domain-containing protein 8
    • UBXD8
    • UBXN3B
    see all
  • Function

    May play a role in the translocation of terminally misfolded proteins from the endoplasmic reticulum lumen to the cytoplasm and their degradation by the proteasome.
  • Tissue specificity

    Broadly expressed, with highest levels in brain.
  • Sequence similarities

    Contains 1 UBA domain.
    Contains 1 UBX domain.
  • Cellular localization

    Cytoplasm. Lipid droplet. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab161568 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up