Overview

  • Product name

    Recombinant Human UBXN1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDE PLETPLGHILGREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLE LVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEER RREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSS PSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEE LGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTRNWGSREAC LGKGGMQREGAL
    • Amino acids

      1 to 312
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as LOC51035

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2B28
    • 4930455J02Rik
    • D19Ertd721e
    • MGC124706
    • MGC6696
    • mY33K
    • Protein 2B28
    • RGD1309471
    • SAKS1
    • SAPK substrate protein 1
    • T25529
    • UBA/UBX 33.3 kDa protein
    • UBX domain containing protein 1
    • UBX domain protein 1
    • UBXD10
    • UBXN1
    see all
  • Relevance

    Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems. 2 named isoforms exist.
  • Cellular localization

    Cytoplasm

Images

  • ab162400 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up