Description

  • Product name

    Recombinant Human UCHL3 protein (His tag)
    See all UCHL3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCA VLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLI HAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETS AHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETL LEDAIEVCKKFMERDPDELRFNAIALSAA
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      2 to 230
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (AAH18125).

Specifications

Our Abpromise guarantee covers the use of ab220563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Ubiquitin carboxyl-terminal hydrolase isozyme L3
    • Ubiquitin thioesterase L3
    • Ubiquitin thiolesterase
    • Ubiquitin thiolesterase L3
    • UCH L3
    • UCH-L3
    • UCHL3
    • UCHL3_HUMAN
    see all
  • Function

    Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, and testis.
  • Sequence similarities

    Belongs to the peptidase C12 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220563 stained overnight with Coomassie Blue.

    The reducing protein migrates as 27 kDa.

References

ab220563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up