Description

  • Product name

    Recombinant Human UCK protein (denatured)
    See all UCK proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMFYSQEIRDMFHLRLFVDTDSDVRLSRRVL RDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAIN LIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLE SS
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      143 to 273
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_113620.1
  • Description

    Recombinant Human UCK protein

Specifications

Our Abpromise guarantee covers the use of ab181890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • Cytidine monophosphate kinase
    • Cytidine monophosphokinase 1
    • Cytidylate kinase
    • Deoxycytidylate kinase
    • FLJ12255
    • OTTHUMP00000022400
    • OTTHUMP00000022401
    • OTTHUMP00000022403
    • OTTHUMP00000022404
    • RP11-334J6.5
    • UCK 1
    • uck1
    • UCK1_HUMAN
    • UMP-CMP kinase
    • Uridine monophosphokinase 1
    • Uridine-cytidine kinase 1
    • Uridine/cytidine kinase 1
    • URK1
    see all
  • Function

    Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    Pyrimidine metabolism; CTP biosynthesis via salvage pathway; CTP from cytidine: step 1/3.
    Pyrimidine metabolism; UMP biosynthesis via salvage pathway; UMP from uridine: step 1/1.
  • Sequence similarities

    Belongs to the uridine kinase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab181890.

References

ab181890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up