Overview

  • Product name
    Recombinant Human UCMA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEER SREAVEQWRQWHYDG LHPSYLYNRHHT
    • Molecular weight
      10 kDa
    • Amino acids
      65 to 138
    • Additional sequence information
      Unique cartilage matrix-associated protein C-terminal fragment

Specifications

Our Abpromise guarantee covers the use of ab185848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Assessed also by SEC-HPLC
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.30
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution

General Info

  • Alternative names
    • 1110017I16Rik
    • AW121955
    • C10orf49
    • Gla rich protein
    • Gla-rich protein
    • GRP
    • OTTMUSP00000011599
    • RP23-272I15.1
    • UCMA
    • Ucma-C
    • UCMA_HUMAN
    • Unique cartilage matrix associated protein
    • Unique cartilage matrix-associated protein C-terminal fragment
    • Upper zone of growth plate and cartilage matrix associated
    see all
  • Function
    May be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
  • Tissue specificity
    Predominantly expressed in resting chondrocytes.
  • Sequence similarities
    Belongs to the UCMA family.
  • Post-translational
    modifications
    Proteolytically cleaved by a furin-like convertase to generate a persistent C-terminal fragment found in almost the entire cartilage matrix, and affecting osteoblast differentiation.
    Sulfated on tyrosine residues.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab185848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up