Overview

  • Product name
    Recombinant Human UCN2/SRP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSA APTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQAT TNARILARVGHC
    • Amino acids
      1 to 112
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as UCN2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SRP
    • Stresscopin related peptide
    • Stresscopin-related peptide
    • Ucn II
    • Ucn2
    • UCN2_HUMAN
    • UCNI
    • UCNII
    • UR
    • Urocortin II
    • Urocortin related peptide
    • Urocortin-2
    • Urocortin-related peptide
    • URP
    see all
  • Function
    Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
  • Sequence similarities
    Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab164813 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up