Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
    • Molecular weight

      30 kDa including tags
    • Amino acids

      232 to 267

Specifications

Our Abpromise guarantee covers the use of ab152782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • mitochondrial brown fat uncoupling protein
    • Mitochondrial brown fat uncoupling protein 1
    • SLC25A7
    • Solute carrier family 25 member 7
    • Thermogenin
    • UCP
    • UCP 1
    • UCP1
    • UCP1_HUMAN
    • Uncoupling protein 1
    • uncoupling protein 1 (mitochondrial, proton carrier)
    see all
  • Function

    UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
  • Tissue specificity

    Brown adipose tissue.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152782 stained with Coomassie Blue.

References

ab152782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up