Description

  • Product name

    Recombinant Human UCP2 protein
    See all UCP2 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVGFKATDVPPTATVKFLGAGTAACIADLITFPLGTAKVRLQIQGESQGP VRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLY DSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARA GGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLI KDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQY SSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 309

Specifications

Our Abpromise guarantee covers the use of ab152783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BMIQ4
    • Mitochondrial uncoupling protein 2
    • SLC25A8
    • Solute carrier family 25 member 8
    • UCP 2
    • ucp2
    • UCP2_HUMAN
    • UCPH
    • Uncoupling protein 2
    • Uncoupling protein 2 mitochondrial proton carrier
    see all
  • Function

    UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
  • Tissue specificity

    Widely expressed in adult human tissues, including tissues rich in macrophages. Most expressed in white adipose tissue and skeletal muscle.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152783 stained with Coomassie Blue.

References

ab152783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up