Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYII TNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRDIMI
    • Amino acids
      281 to 379
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8430408E05Rik
    • ATTP
    • EV and lactate malate dehydrogenase domain containing protein
    • EV and lactate/malate dehydrogenase domain-containing protein
    • FLJ11068
    • signaling molecule ATTP
    • ubiquitin conjugating enzyme E2 like
    • Ubiquitin conjugating enzyme E2 variant 3
    • Ubiquitin E2 variant and lactate/malate dehydrogenase domain containing protein
    • Ubiquitin-conjugating enzyme E2 variant 3
    • UEV 3
    • UEV and lactate malate dehyrogenase domains
    • UEV-3
    • UEV2 and LDH domains containing protein
    • UEV3
    • uevld
    • UEVLD_HUMAN
    see all
  • Function
    Possible negative regulator of polyubiquitination.
  • Tissue specificity
    Colon, colon carcinoma cell lines, normal cervical epithelium, carcinomas of the uterine cervix and peripheral blood leukocytes.
  • Sequence similarities
    In the N-terminal section; belongs to the ubiquitin-conjugating enzyme family. UEV subfamily.
    In the C-terminal section; belongs to the LDH/MDH superfamily.
    Contains 1 UEV (ubiquitin E2 variant) domain.
  • Information by UniProt

Images

  • ab163052 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up