Description

  • Product name

    Recombinant Human UFC1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab107151 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQ RLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEF DIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVP KFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 167
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • CGI-126
    • HSPC155
    • Ubiquitin fold modifier conjugating enzyme 1
    • Ubiquitin-fold modifier-conjugating enzyme 1
    • UFC1
    • UFC1_HUMAN
    • Ufm1 conjugating enzyme 1
    • Ufm1-conjugating enzyme 1
    see all
  • Function

    E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family. UFC1 subfamily.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107151 (3µg).

References

This product has been referenced in:

  • Tellermann A  et al. Autoantibodies binding to ubiquitin-fold modifier-conjugating enzyme 1 (Ufc1) and pleckstrin homology domain containing, family G (with RhoGef domain) member 2 (Plekhg2) are associated with mycobacterial infections. HIV Med 16:114-21 (2015). Read more (PubMed: 25213431) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up