Overview

  • Product name

    Recombinant Human UFL1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHT LDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLIHIENRIGDI IKSEKHVQLVLGQLIDENYLDRLAEEVNDKLQESGQVTISELCKTYDLPG NFLTQALTQRLGRIISGHIDLDNRGVIFTEAFVARHKARIRGLFSAITRP TAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYS RTQSTWVDSFFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFLKAAC VGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFS KQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMKNNPVHLITEED LKQISTLESVSTSKKDKKDERRRKATEGSGSMRGGGGGNAREYKIKKVKK KGRKDDDSDDESQSSHTGKKKPEISFMFQDEIEDFLRKHIQDAPEEFISE LAEYLIKQV
    • Amino acids

      1 to 509
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as K0776

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 UFM1-protein ligase 1
    • KIAA0776
    • LZAP-binding protein
    • Maxer
    • NLBP
    • RCAD
    • UFL1
    • UFL1_HUMAN
    • UFM1 specific ligase 1
    see all
  • Function

    E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown. May act as a tumor suppressor by inhibiting cell invasion, blocking NF-kappa-B signaling and increasing stability of CDK5RAP3.
  • Tissue specificity

    Ubiquitously expressed, with a high expression in liver (at protein level). Low expression in several invasive hepatocellular carcinomas, such HepG2, Hep3B, HLE and PLC.
  • Sequence similarities

    Belongs to the UFL1 family.
  • Post-translational
    modifications

    Ubiquitinated, leading to its degradation by the proteasome. Interaction with CDK5RAP3 protects each other against ubiquitination and degradation via the proteasome.
  • Cellular localization

    Endoplasmic reticulum. Cytoplasm. In cytoplasm colocalizes with CDK5RAP3.
  • Information by UniProt

Images

  • ab161615 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up