Description

  • Product name

    Recombinant Human UGDH protein
    See all UGDH proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab96771 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMFEIKKICCIG AGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVV ESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEA CARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPE FLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTT NTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRI GNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQR RRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEG AHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAV VICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIET IGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 494
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.42% Sodium fluoride, 0.0154% DTT, 0.316% Tris HCl, 0.0292% EDTA, 20% Glycerol

General Info

  • Alternative names

    • GDH
    • UDP Glc dehydrogenase
    • UDP GlcDH
    • UDP glucose 6 dehydrogenase
    • UDP glucose dehydrogenase
    • UDP-Glc dehydrogenase
    • UDP-GlcDH
    • UDP-glucose 6-dehydrogenase
    • UDP-glucose dehydrogenase
    • UDPGDH
    • UGD
    • Ugdh
    • UGDH_HUMAN
    • Uridine diphospho glucose dehydrogenase
    see all
  • Function

    Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.
  • Tissue specificity

    Widely expressed.
  • Pathway

    Nucleotide-sugar biosynthesis; UDP-alpha-D-glucuronate biosynthesis; UDP-alpha-D-glucuronate from UDP-alpha-D-glucose: step 1/1.
  • Sequence similarities

    Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab96771 at approximately 59.5kDa (3µg).

References

ab96771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up