Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLL EASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDN LHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKIN EIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHK VLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQ VKTVTNTTVEDETETNEVQGFLFGKLKS
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 277

Specifications

Our Abpromise guarantee covers the use of ab132777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as UGCGL2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ10873
    • FLJ11485
    • HUGT2
    • MGC117360
    • MGC150689
    • MGC87276
    • Moderately similar to UDP glucose:glycoprotein glucosyltransferase
    • UDP Glc glycoprotein glucosyltransferase 2
    • UDP glucose ceramide glucosyltransferase like 1
    • UDP glucose ceramide glucosyltransferase like 2
    • UDP glucose glycoprotein glucosyltransferase 2
    • UGCGL 2
    • UGCGL2
    • UGGT2
    • UGT2
    see all
  • Relevance

    UGGT2 belongs to the glycosyltransferase 8 family. It recognizes glycoproteins with minor folding defects and reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation (By similarity).
  • Cellular localization

    Endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment.

Images

  • 12.5% SDS-PAGE analysis of ab132777, stained with Coomassie Blue.

References

ab132777 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up