Description

  • Product name

    Recombinant Human UGPase protein
  • Purity

    > 85 % SDS-PAGE.
    ab187440 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSRFVQDLSKAMSQDGASQFQEVIRQE LELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGK IQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPK SLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQK YNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIY ASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCE FVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIF NTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIK SFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTV PLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVI IIANHGDRIDIPPGAVLENKIVSGNLRILDH
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      1 to 508
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006750

Specifications

Our Abpromise guarantee covers the use of ab187440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as UGP2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 79% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • pHC379
    • UDP glucose diphosphorylase
    • UDP glucose pyrophosphorylase
    • UDP glucose pyrophosphorylase 1
    • UDP glucose pyrophosphorylase 2
    • UDP-glucose pyrophosphorylase
    • UDPG
    • UDPGP
    • UDPGP 2
    • UDPGP2
    • UGP 1
    • UGP 2
    • UGP1
    • Ugp2
    • UGPA_HUMAN
    • UGPase
    • UGPase 2
    • UGPP 1
    • UGPP 2
    • UGPP1
    • UGPP2
    • Uridyl diphosphate glucose pyrophosphorylase 1
    • Uridyl diphosphate glucose pyrophosphorylase 2
    • UTP glucose 1 phosphate uridyltransferase
    • UTP glucose 1 phosphate uridylyltransferase
    • UTP glucose 1 phosphate uridylyltransferase 2
    • UTP--glucose-1-phosphate uridylyltransferase
    see all
  • Function

    Plays a central role as a glucosyl donor in cellular metabolic pathways.
  • Sequence similarities

    Belongs to the UDPGP type 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of ab187440.

References

ab187440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up