Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFEND SFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPF LPCSPI
    • Amino acids
      54 to 159
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BILIQTL1
    • Bilirubin specific UDPGT isozyme 1
    • bilirubin UDP glucuronosyltransferase 1 1
    • bilirubin UDP glucuronosyltransferase isozyme 1
    • Bilirubin-specific UDPGT isozyme 1
    • EC 2.4.1.17
    • GNT1
    • HUG BR1
    • HUG-BR1
    • HUGBR1
    • PHENOL/BILIRUBIN UDP GLUCURONOSYLTRANSFERASE
    • UD11_HUMAN
    • UDP glucuronosyltransferase 1 1 [Precursor]
    • UDP glucuronosyltransferase 1 family polypeptide A1
    • UDP glucuronosyltransferase 1A1
    • UDP GLYCOSYLTRANSFERASE 1
    • UDP-glucuronosyltransferase 1-1
    • UDP-glucuronosyltransferase 1-A
    • UDP-glucuronosyltransferase 1A1
    • UDPGT
    • UDPGT 1-1
    • UGT 1A
    • UGT-1A
    • UGT1
    • UGT1 01
    • UGT1*1
    • UGT1-01
    • UGT1.1
    • UGT1A
    • Ugt1a1
    • URIDINE DIPHOSPHATE GLUCURONOSYLTRANSFERASE, BILIRUBIN/PHENOL
    • URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1
    • URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1 FAMILY, POLYPEPTIDE A1
    see all
  • Information by UniProt

Images

  • ab162807 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up