Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHAGKILLIPVDGSHWLSMLGAIQQLQQ RGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFEN DSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDP FLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSD HMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSAS VWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGI VVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILV KWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAK RMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPV EPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLD
    • Molecular weight

      55 kDa including tags
    • Amino acids

      25 to 490
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000454.

Specifications

Our Abpromise guarantee covers the use of ab202607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab202607 was purified by conventional chromatography techniques
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • BILIQTL1
    • Bilirubin specific UDPGT isozyme 1
    • bilirubin UDP glucuronosyltransferase 1 1
    • bilirubin UDP glucuronosyltransferase isozyme 1
    • Bilirubin-specific UDPGT isozyme 1
    • EC 2.4.1.17
    • GNT1
    • HUG BR1
    • HUG-BR1
    • HUGBR1
    • PHENOL/BILIRUBIN UDP GLUCURONOSYLTRANSFERASE
    • UD11_HUMAN
    • UDP glucuronosyltransferase 1 1 [Precursor]
    • UDP glucuronosyltransferase 1 family polypeptide A1
    • UDP glucuronosyltransferase 1A1
    • UDP GLYCOSYLTRANSFERASE 1
    • UDP-glucuronosyltransferase 1-1
    • UDP-glucuronosyltransferase 1-A
    • UDP-glucuronosyltransferase 1A1
    • UDPGT
    • UDPGT 1-1
    • UGT 1A
    • UGT-1A
    • UGT1
    • UGT1 01
    • UGT1*1
    • UGT1-01
    • UGT1.1
    • UGT1A
    • Ugt1a1
    • URIDINE DIPHOSPHATE GLUCURONOSYLTRANSFERASE, BILIRUBIN/PHENOL
    • URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1
    • URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1 FAMILY, POLYPEPTIDE A1
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202607 (3μg).

References

ab202607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up