Overview

  • Product name
    Recombinant Human UGT1A4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIKEEKFFTLTAYAVP WTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCC
    • Amino acids
      34 to 128
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bilirubin UDP glucuronosyltransferase isozyme 2
    • Bilirubin-specific UDPGT isozyme 2
    • HUG-BR2
    • UD14_HUMAN
    • UDP glucuronosyltransferase 1 family polypeptide A4
    • UDP glycosyltransferase 1 family polypeptide A4
    • UDP-glucuronosyltransferase 1-4
    • UDP-glucuronosyltransferase 1-D
    • UDP-glucuronosyltransferase 1A4
    • UDPGT
    • UDPGT 1-4
    • UGT-1D
    • UGT1*4
    • UGT1-04
    • UGT1.4
    • UGT1A4
    • UGT1D
    see all
  • Function
    UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate.
  • Tissue specificity
    Expressed in liver. Not expressed in skin or kidney.
  • Involvement in disease
    Defects in UGT1A4 are the cause of Gilbert syndrome (GILBS) [MIM:143500]. Gilbert syndrome occurs as a consequence of reduced bilirubin transferase activity and is often detected in young adults with vague nonspecific complaints.
    Defects in UGT1A4 are the cause of Crigler-Najjar syndrome type 1 (CN1) [MIM:218800]. CN1 patients have severe hyperbilirubinemia and usually die of kernicterus (bilirubin accumulation in the basal ganglia and brainstem nuclei) within the first year of life. CN1 inheritance is autosomal recessive.
    Defects in UGT1A4 are the cause of Crigler-Najjar syndrome type 2 (CN2) [MIM:606785]. CN2 patients have less severe hyperbilirubinemia and usually survive into adulthood without neurologic damage. Phenobarbital, which induces the partially deficient glucuronyl transferase, can diminish the jaundice. CN2 inheritance is autosomal dominant.
  • Sequence similarities
    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization
    Microsome. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162806 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up