Description

  • Product name

    Recombinant Human UGT2B4 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKF EVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILR
    • Amino acids

      25 to 124
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EC 2.4.1.17
    • HLUG25
    • Hyodeoxycholic acid
    • Hyodeoxycholic acid specific UDPGT
    • UDP glucuronosyltransferase 2 family polypeptide B4
    • UDP glucuronosyltransferase 2B4
    • UDP glucuronosyltransferase 2B4 precursor
    • UDP glucuronyltransferase family 2 beta 4
    • UDP glycosyltransferase
    • UDP glycosyltransferase 2 family polypeptide B4
    • UDPGT
    • UDPGT 2B4
    • UDPGT2B4
    • UDPGTh 1
    • UDPGTh1
    • UGT2B11
    • UGT2B4
    see all
  • Relevance

    The UDP-Glucuronosyltransferases (UGT) comprise a family of enzymes that detoxify and enhance the urinary excretion of a wide variety of xenobiotic and endogenous substrates by transferring glucuronic acid to sulfhydryl, hydroxyl, aromatic amino, or carboxylic acid groups. They have been subdivided into two families, UGT1 and UGT2, based on the evolutionary divergence of their genes. The enzymes of the UGT1A family play an important role in the metabolism of dietary constituents, phenols, and therapeutic drugs, and also the glucuronidation of bilirubin and iodothyronines. The enzymes of the UGT2B family are involved in the metabolism of bile acids, phenol derivatives, catecholestrogens and steroids. Although it is widely recognized that the liver is the major site of glucuronidation, it is now clear that UGT enzymes are also found in extra-hepatic tissues.
  • Cellular localization

    Microsome

Images

  • ab159778 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up