Overview

  • Product name
    Recombinant Human UGT3A2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGQRVLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHG HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET LGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNENFDMVIVETFDYC PFLIAEKLGKPFVAILSTSFGSLEFGLPIPLSYVPVFRSLLTDHMDFWGR VKNFLMFFSFCRRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFIN SDFAFDFARPLLPNTVYVGGLMEKPIKPVPQDLENFIAKFGDSGFVLVTL GSMVNTCQNPEIFKEMNNAFAHLPQGVIWKCQCSHWPKDVHLAANVKIVD WLPQSDLLAHPSIRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVR VEAKKFGVSIQLKKLKAETLALKMKQIMEDKRYKSAAVAASVILRSHPLS PTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDVFVFLLGLTLGTL WLCGKLLGMAVWWLRGARKVKET
    • Amino acids
      1 to 523
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.4.1.17
    • MGC119426
    • MGC119429
    • OTTHUMP00000221219
    • UD3A2_HUMAN
    • UDP glucuronosyltransferase 3A2
    • UDP glycosyltransferase 3 family polypeptide A2
    • UDP-glucuronosyltransferase 3A2
    • UDPGT 3A2
    • Ugt3a2
    see all
  • Function
    UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
  • Sequence similarities
    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165791 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up