Description

  • Product name

    Recombinant Human UHRF1 protein
  • Purity

    > 70 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHDYKDDDDKWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELF HVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKER DSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYK VNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHV KYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERG FWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEG SPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDEC DMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKM ASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQV SESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDL SGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVV RNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDE PGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGG FASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIRE DKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPIT TVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLF PGYGNGR
    • Predicted molecular weight

      92 kDa including tags
    • Amino acids

      2 to 793
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      NM_001048201.

Specifications

Our Abpromise guarantee covers the use of ab198770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% Tween, 20% Glycerol

    100 µg/ml DDDDK peptide

General Info

  • Alternative names

    • Ac2-121
    • AL022808
    • E3 ubiquitin-protein ligase UHRF1
    • EC 6.3.2.-
    • FLJ21925
    • hNP95
    • hUHRF1
    • HuNp95
    • ICBP90
    • Inverted CCAAT box binding protein of 90 kDa
    • Inverted CCAAT box binding protein, 90-kD
    • Inverted CCAAT box-binding protein of 90 kDa
    • Liver regeneration-related protein LRRG126
    • MGC138707
    • NP95
    • Nuclear phosphoprotein 95
    • Nuclear phosphoprotein, 95-KD
    • Nuclear protein 95
    • Nuclear zinc finger protein Np95
    • RING finger protein 106
    • RNF106
    • TDRD22
    • Transcription factor ICBP90
    • Ubiquitin like containing PHD and RING finger domains protein 1
    • Ubiquitin like PHD and RING finger domain containing protein 1
    • Ubiquitin-like PHD and RING finger domain-containing protein 1
    • Ubiquitin-like protein containing PHD and RING finger domains 1
    • Ubiquitin-like with PHD and ring finger domains 1
    • Ubiquitin-like, containing PHD and RING finger domains, 1
    • Ubiquitin-like-containing PHD and RING finger domains protein 1
    • UHRF1
    • UHRF1_HUMAN
    see all
  • Function

    Putative E3 ubiquitin-protein ligase. May participate in methylation-dependent transcriptional regulation. Binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. Important for G1/S transition. May be involved in DNA repair and chromosomal stability.
  • Tissue specificity

    Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 PHD-type zinc finger.
    Contains 2 RING-type zinc fingers.
    Contains 1 ubiquitin-like domain.
    Contains 1 YDG domain.
  • Developmental stage

    Expressed in fetal thymus, liver and kidney.
  • Domain

    The RING finger is required for ubiquitin ligase activity.
    The YDG domain mediates the interaction with histone H3.
  • Post-translational
    modifications

    Phosphorylated on serine residues. Phosphorylation may enhance DNA-binding activity.
    Ubiquitinated; which leads to proteasomal degradation. Polyubiquitination may be stimulated by DNA damage.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198770 with Coomassie staining.

    Lane 1: 2 µg ab198770
    Lane 2: Protein marker

References

ab198770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up