Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS PLGKKLNVTT AWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHS SGSWQFSFDG QIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLE DFLMGMDSTL EPSAGAPLAMSSVDHHHHHH
    • Molecular weight

      23 kDa including tags
    • Amino acids

      26 to 216
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151636 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99.2% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • ALCAN alpha
    • ALCAN-alpha
    • N2DL 2
    • N2DL-2
    • N2DL2
    • N2DL2_HUMAN
    • NKG2D ligand 2
    • NKG2D ligand 2 precursor
    • NKG2DL2
    • RAET1H
    • Retinoic acid early transcript 1 H
    • Retinoic acid early transcript 1H
    • UL16 binding protein 2
    • UL16-binding protein 2
    • ULBP2
    see all
  • Function

    Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.
  • Tissue specificity

    Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
  • Sequence similarities

    Belongs to the MHC class I family.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt

References

ab151636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up