Recombinant Human ULBP2 protein (His tag) (ab219455)
Key features and details
- Expression system: Baculovirus infected insect cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
Description
-
Product name
Recombinant Human ULBP2 protein (His tag)
See all ULBP2 proteins and peptides -
Purity
> 90 % SDS-PAGE.
Affinity purified -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Baculovirus infected insect cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ADPGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVT PVSPLGKKLNVTTAWKAQNP VLREVVDILT EQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFD SEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMD STLEPSAGAPLAMSHHHHHH -
Predicted molecular weight
23 kDa including tags -
Amino acids
26 to 216 -
Tags
His tag C-Terminus -
Additional sequence information
Mature protein without signal and propetides.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219455 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 10% Glycerol (glycerin, glycerine), 90% PBS
General Info
-
Alternative names
- ALCAN alpha
- ALCAN-alpha
- N2DL 2
see all -
Function
Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface. -
Tissue specificity
Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. -
Sequence similarities
Belongs to the MHC class I family. -
Cellular localization
Cell membrane. Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab219455 has not yet been referenced specifically in any publications.