Description

  • Product name

    Recombinant Human ULBP2 protein (His tag)
    See all ULBP2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVT PVSPLGKKLNVTTAWKAQNP VLREVVDILT EQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFD SEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMD STLEPSAGAPLAMSHHHHHH
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      26 to 216
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal and propetides.

Specifications

Our Abpromise guarantee covers the use of ab219455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • ALCAN alpha
    • ALCAN-alpha
    • N2DL 2
    • N2DL-2
    • N2DL2
    • N2DL2_HUMAN
    • NKG2D ligand 2
    • NKG2D ligand 2 precursor
    • NKG2DL2
    • RAET1H
    • Retinoic acid early transcript 1 H
    • Retinoic acid early transcript 1H
    • UL16 binding protein 2
    • UL16-binding protein 2
    • ULBP2
    see all
  • Function

    Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.
  • Tissue specificity

    Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
  • Sequence similarities

    Belongs to the MHC class I family.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3ug of ab219455.

References

ab219455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up