Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGA HNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC
    • Molecular weight

      36 kDa including tags
    • Amino acids

      25 to 120

Specifications

Our Abpromise guarantee covers the use of ab152789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as Uromucoid. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADMCKD2
    • FJHN
    • HNFJ
    • HNFJ1
    • MCKD2
    • medullary cystic kidney disease 2 (autosomal dominant)
    • Tamm Horsfall glycoprotein
    • Tamm Horsfall urinary glycoprotein
    • Tamm-Horsfall urinary glycoprotein
    • THGP
    • THP
    • Umod
    • Urehd1
    • urehr4
    • UROM_HUMAN
    • Uromodulin
    • uromodulin (uromucoid, Tamm-Horsfall glycoprotein)
    • Uromodulin, secreted form
    • Uromucoid
    see all
  • Function

    Not known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity.
  • Tissue specificity

    Synthesized by kidney. Most abundant protein in normal human urine.
  • Involvement in disease

    Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
    Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
    Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 1 ZP domain.
  • Cellular localization

    Cell membrane. Secreted. Secreted after cleavage in the urine.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152789 stained with Coomassie Blue.

References

ab152789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up