Recombinant Human UNC45A protein (ab163268)

Overview

  • Product name
    Recombinant Human UNC45A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGL DATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQ ALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTD AKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSNGVQLL QRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVES QAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIVDPARELKVLISNLLD LLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEV GGSLQDPPGELAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIK SWFEGQGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEQ EEEQLVAVEALIHAAGKAKRASFITANGVSLLKDLYKCSEKDSIRIRALV GLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEG LAYLTFDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSY DYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLAAGVVSAMVC MVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEG TDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVRPLVSLLHLNCSGLQN FEALMALTNLAGISERLRQKILKEKAVPMIEGYMFEEHEMIRRAATECMC NLAMSKEVQDLFEAQGNDRLKLLVLYSGEDDELLQRAAAGGLAMLTSMRP TLCSRIPQVTTHWLEILQALLLSSNQELQHRGAVVVLNMVEASREIASTL MESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDGE
    • Amino acids
      1 to 944
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW538196
    • FLJ10043
    • GC UNC45
    • GCUNC 45
    • GCUNC45
    • General cell UNC45
    • IRO039700
    • MGC125248
    • OTTMUSP00000030133
    • Protein unc-45 homolog A
    • Protein unc45 homolog A
    • RGD1305357
    • SMAP 1
    • SMAP1
    • Smooth muscle cell associated protein 1
    • Stromal membrane-associated protein 1
    • Unc-45 homolog A (C. elegans)
    • Unc-45A
    • Unc45 homolog A (C. elegans)
    see all
  • Relevance
    UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway (Price et al., 2002 [PubMed 12356907]).
  • Cellular localization
    Cytoplasm. Cytoplasm, perinuclear region. Nucleus. Note: Predominant in the perinuclear region. Little protein in the nucleus.

Images

  • ab163268 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up