Overview

  • Product name
    Recombinant Human UNC45B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEVEAVQLKEEGNRHFQLQDYKAATNSYSQALKLTKDKALLATLYRNRA ACGLKTESYVQAASDASRAIDINSSDIKALYRRCQALEHLGKLDQAFKDV QRCATLEPRNQNFQEMLRRLNTSIQEKLRVQFSTDSRVQKMFEILLDENS EADKREKAANNLIVLGREEAGAEKIFQNNGVALLLQLLDTKKPELVLAAV RTLSGMCSGHQARATVILHAVRIDRICSLMAVENEEMSLAVCNLLQAIID SLSGEDKREHRGKEEALVLDTKKDLKQITSHLLDMLVSKKVSGQGRDQAL NLLNKNVPRKDLAIHDNSRTIYVVDNGLRKILKVVGQVPDLPSCLPLTDN TRMLASILINKLYDDLRCDPERDHFRKICEEYITGKFDPQDMDKNLNAIQ TVSGILQGPFDLGNQLLGLKGVMEMMVALCGSERETDQLVAVEALIHAST KLSRATFIITNGVSLLKQIYKTTKNEKIKIRTLVTSDKTILYSVATTLVN CTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFIDMRVKRLLKAGVI SALACMVKADSAILTDQTKELLARVFLALCDNPKDRGTIVAQGGGKALIP LALEGTDVGKVKAAHALAKIAAVSNPDIAFPGERVYEVVRPLVRLLDTQR DGLQNYEALLGLTNLSGRSDKLRQKIFKERALPDIENYMFENHDQLRQAA TECMCNMVLHKEVQERFLADGNDRLKLVVLLCGEDDDKVQNAAAGALAML TAAHKKLCLKMTQVTTQWLEILQRLCLHDQLSVQHRGLVIAYNLLAADAE LAKKLVESELLEILTVVGKQEPDEKKAEVVQTARECLIKCMDYGFIKPVS
    • Amino acids
      1 to 850
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cardiomyopathy associated 4
    • CMYA4
    • FLJ38610
    • MGC119540
    • MGC119541
    • OTTHUMP00000163855
    • Protein unc 45 homolog B
    • Protein unc-45 homolog B
    • SMUNC45
    • Striated muscle UNC45
    • UN45B_HUMAN
    • Unc 45 homolog B
    • Unc 45 homolog B (C. elegans)
    • UNC 45B
    • UNC-45B
    • UNC45
    • UNC45B
    see all
  • Function
    Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell development.
  • Sequence similarities
    Contains 3 ARM repeats.
    Contains 3 TPR repeats.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • ab165542 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up