Description

  • Product name

    Recombinant Human UNC50 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAA WQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFG FVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYD VEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLV AVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTL CSFYKYRVK
    • Amino acids

      1 to 259
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp564G0222
    • Geal 6 membrane associated high copy suppressor 1
    • GMH1
    • hGMH1
    • HSD23
    • PDLs22
    • Periodontal ligament specific protein 22
    • Periodontal ligament-specific protein 22
    • Protein GMH1 homolog
    • Protein unc 50 homolog
    • Protein unc-50 homolog
    • Unc 50 homolog
    • Unc 50 homolog (C. elegans)
    • Unc 50 related
    • unc50
    • UNC50_HUMAN
    • UNCL
    • Uncoordinated like protein
    • Uncoordinated-like protein
    • URP
    see all
  • Function

    May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA.
  • Tissue specificity

    Present in periodontal ligament fibroblasts (at protein level).
  • Sequence similarities

    Belongs to the unc-50 family.
  • Cellular localization

    Nucleus inner membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161851 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up