Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQ IYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY
    • Amino acids

      27 to 126
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6330415E02Rik
    • A630020F16
    • D10Bwg0792e
    • Netrin receptor UNC5B
    • Netrin receptor UNC5B Precursor
    • p53 regulated receptor for death and life
    • p53 regulated receptor for death and life protein 1
    • p53-regulated receptor for death and life protein 1
    • p53RDL1
    • Protein unc-5 homolog 2
    • Protein unc-5 homolog B
    • Protein XUNC 5
    • Transmembrane receptor Unc5H2
    • Unc 5 homolog 2
    • Unc 5 homolog B
    • Unc 5 netrin receptor B
    • UNC 5B
    • Unc5 (C.elegans homolog) b
    • Unc5b
    • UNC5B_HUMAN
    • UNC5H2
    see all
  • Function

    Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion (By similarity). Functions as netrin receptor that negatively regulates vascular branching during angiogenesis. Mediates retraction of tip cell filopodia on endothelial growth cones in response to netrin (By similarity). It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (PubMed:12598906). Mediates apoptosis by activating DAPK1. In the absence of NTN1, activates DAPK1 by reducing its autoinhibitory phosphorylation at Ser-308 thereby increasing its catalytic activity.
  • Tissue specificity

    Highly expressed in brain. Also expressed at lower level in developing lung, cartilage, kidney and hematopoietic and immune tissues.
  • Sequence similarities

    Belongs to the unc-5 family.
    Contains 1 death domain.
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 TSP type-1 domains.
    Contains 1 ZU5 domain.
  • Post-translational
    modifications

    Phosphorylated on cytoplasmic tyrosine residues.
    Proteolytically cleaved by caspases during apoptosis. The cleavage does not take place when the receptor is associated with netrin ligand. Its cleavage by caspases is required to induce apoptosis.
    Palmitoylation is required for pro-apoptotic activity, but not for location at lipid rafts.
  • Cellular localization

    Cell membrane. Membrane raft. Associated with lipid rafts.
  • Information by UniProt

Images

  • ab153628 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up