Overview

  • Product name
    Recombinant Human UNC93B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRF FGT
    • Amino acids
      83 to 135
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hUNC93B1
    • IIAE1
    • Protein unc 93 homolog B1
    • Protein UNC 93B
    • unc 93 homolog B1
    • unc 93 homolog B1 (C elegans)
    • unc 93 related protein
    • Unc 93B1
    • UNC93
    • unc93 (C elegans) homolog B
    • unc93 (C elegans) homolog B1
    • UNC93B
    • UNC93B1
    see all
  • Relevance
    UNC93B is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm. Defects in UNC93B are associated with susceptibility to herpes simplex encephalitis (HSE) which is a rare complication of human herpesvirus 1 (HHV-1) infection.
  • Cellular localization
    Membrane; Multi pass membrane protein

Images

  • ab164351 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up