Description

  • Product name

    Recombinant Human Unrip protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGD WIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHK HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL WCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVI TYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKY DYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTY GLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 350

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MAP activator with WD repeats
    • MAWD
    • PTWD
    • Serine-threonine kinase receptor-associated protein
    • serine/threonine kinase receptor associated protein
    • strap
    • STRAP_HUMAN
    • UNR-interacting protein
    • UNRIP
    • WD 40 repeat protein PT WD
    • WD-40 repeat protein PT-WD
    see all
  • Function

    The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein.
  • Sequence similarities

    Belongs to the WD repeat STRAP family.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm. Nucleus. Localized predominantly in the cytoplasm but also found in the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132509 stained with Coomassie Blue.

References

ab132509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Ab132509 (Human Unrip full length protein) is sold in: 10 mM reduced Glutathione in 50 mM Tris-HCI, pH=8.0.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up