Overview

  • Product name
    Recombinant human uPA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQ KTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVI SATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTL AHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGK ENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWK TDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHTKEENGLAL
    • Molecular weight
      45 kDa including tags
    • Amino acids
      21 to 431
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to cleave a peptide substrate, N - carbobenzyloxy - Gly - Gly - Arg - 7 - amido - 4 - methylcoumarin (Z - GGR - AMC). The specific activity is > 2000 pmoles/min/µg.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS
    Note: Normally Mannitol or Trehalose are added as protectants before lyophilization.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 50µl sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • ATF
    • BDPLT5
    • EC 3.4.21.73
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • UPA
    • UPAM
    • Urinary plasminogen activator
    • URK
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    see all
  • Relevance
    Urokinase type plasminogen activator (uPA) is secreted from cells as a precursor which is activated to the two chain form consisting of an A and B chain. The active high MW form is further processed by removal of an amino terminal fragment to an active low MW form (35 kDa). uPA is a serine protease that activates plasminogen toplasmin. High levels of uPA and plasminogen activator inhibitor type 1 (PAI 1) in breast cancer tissue extracts have been associated with rapid disease progression. The malignant phenotype of prostatic tumor cells correlates with the expression of both uPA and its cell membrane receptor (uPAR).

Images

  • SDS-PAGE of reduced ab167714 stained overnight with Coomassie Blue.
    DTT-reduced Protein migrates as three bands corresponding to the long α chain, β chain and unprocessed full-length chain with the molecular mass of 18 kDa, 32 kDa and 50 kDa respectively due to glycosylation and cleavage.

References

ab167714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up