Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      WGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCG YLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCK GNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQ HAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRVDHHHHHH
    • Molecular weight

      33 kDa including tags
    • Amino acids

      23 to 303
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • CD 87
    • CD87
    • CD87 antigen
    • MO 3
    • MO3
    • Monocyte activation antigen Mo3
    • Plasminogen activator receptor urokinase
    • Plasminogen activator urokinase receptor
    • PLAUR
    • U PAR
    • u plasminogen activator receptor
    • U-PAR
    • u-plasminogen activator receptor form 2
    • UPA receptor
    • uPAR
    • UPAR_HUMAN
    • Urinary plasminogen activator receptor
    • URKR
    • Urokinase plasminogen activator receptor
    • Urokinase plasminogen activator surface receptor
    • urokinase-type plasminogen activator (uPA) receptor
    see all
  • Function

    Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
  • Tissue specificity

    Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
  • Sequence similarities

    Contains 3 UPAR/Ly6 domains.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab151815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up