Description

  • Product name

    Recombinant Human uPA Receptor/U-PAR protein (His tag)
    See all uPA Receptor/U-PAR proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab219440 was purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEK TNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGS SDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYL PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGN STHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHA HLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGLEHHHHHH
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      23 to 305
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This is the mature protein without the signal or propeptide sequences (NP_002650). Predicted N terminal is Leu 23.

Specifications

Our Abpromise guarantee covers the use of ab219440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD 87
    • CD87
    • CD87 antigen
    • MO 3
    • MO3
    • Monocyte activation antigen Mo3
    • Plasminogen activator receptor urokinase
    • Plasminogen activator urokinase receptor
    • PLAUR
    • U PAR
    • u plasminogen activator receptor
    • U-PAR
    • u-plasminogen activator receptor form 2
    • UPA receptor
    • uPAR
    • UPAR_HUMAN
    • Urinary plasminogen activator receptor
    • URKR
    • Urokinase plasminogen activator receptor
    • Urokinase plasminogen activator surface receptor
    • urokinase-type plasminogen activator (uPA) receptor
    see all
  • Function

    Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
  • Tissue specificity

    Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
  • Sequence similarities

    Contains 3 UPAR/Ly6 domains.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219440 (3µg).   

References

ab219440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up