Description

  • Product name

    Recombinant Human UPP2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTH NLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDR YCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGG IGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCS KEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGV RNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQR PQLLISNFIRRRLGLCD
    • Amino acids

      1 to 317
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Liver specific uridine phosphorylase
    • UDRPASE2
    • UP2
    • UPase 2
    • UPASE2
    • UPP 2
    • UPP2
    • UPP2_HUMAN
    • UrdPase 2
    • Uridine phosphorylase 2
    see all
  • Function

    Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.
  • Tissue specificity

    Predominantly expressed in kidney.
  • Pathway

    Pyrimidine metabolism; UMP biosynthesis via salvage pathway; uracil from uridine (phosphorylase route): step 1/1.
  • Sequence similarities

    Belongs to the PNP/UDP phosphorylase family.
  • Information by UniProt

Images

  • ab165629 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up