Overview

  • Product name
    Recombinant Human Upstream Binding Protein 1
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQED SSLPLDGETEHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNR KMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLD IPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGG EKGVPFRIQVDAFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREK MEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADY GDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPN HQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKL TKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCREQPSSTVLQGQQQA ASSASENGSGAPYVYHAIYLEEMIASEVARKLALVFNIPLHQINQVYRQG PTGIHILVSDQMVQNFQDESCFLFSTVKAESSDGIHIILK
    • Amino acids
      1 to 540
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cp2b
    • DKFZp686L1745
    • LBP 1a
    • LBP 1B
    • LBP1
    • LBP1A
    • LBP1B
    • NF2d9
    • Transcription factor LBP-1
    • UBIP1_HUMAN
    • UBP1
    • Upstream binding protein 1
    • Upstream-binding protein 1
    see all
  • Function
    Functions as a transcriptional activator in a promoter context-dependent manner. Modulates the placental expression of CYP11A1. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2 (By similarity). Involved in regulation of the alpha-globin gene in erythroid cells. Binds strongly to sequences around the HIV-1 initiation site and weakly over the TATA-box. Represses HIV-1 transcription by inhibiting the binding of TFIID to the TATA-box.
  • Tissue specificity
    Expressed in adrenal tissue, JEG-3, NCI-H295A, HepG2 and HeLa cell lines.
  • Sequence similarities
    Belongs to the grh/CP2 family. CP2 subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159769 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up