Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQV SLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKG TKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDI VQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQA VEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHL GGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAE TGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALV SHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIY DQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
    • Amino acids

      1 to 480
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Complex III subunit 1
    • Core protein I
    • Cytochrome b-c1 complex subunit 1
    • cytochrome b-c1 complex subunit 1, mitochondrial
    • D3S3191
    • mitochondrial
    • OTTHUMP00000164820
    • QCR1
    • QCR1_HUMAN
    • Ubiquinol cytochrome c reductase complex core protein 1
    • ubiquinol-cytochrome c reductase core protein I
    • Ubiquinol-cytochrome-c reductase complex core protein 1
    • UQCR1
    • Uqcrc1
    see all
  • Function

    This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
  • Sequence similarities

    Belongs to the peptidase M16 family. UQCRC1/QCR1 subfamily.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab159786 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up