Description

  • Product name

    Recombinant Human UQCRC1 protein (denatured)
    See all UQCRC1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab177632 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFTATFAQALQFVPETQVSLLDNGLRV ASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSAL EKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDS QIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVR KLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAE DAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANA IIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFV CDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPV CEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGY GPIEQLPDYN RIRSGMFWLRF
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      35 to 480
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature form (NP_003356)
  • Description

    Recombinant Human UQCRC1 protein

Specifications

Our Abpromise guarantee covers the use of ab177632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • Complex III subunit 1
    • Core protein I
    • Cytochrome b-c1 complex subunit 1
    • cytochrome b-c1 complex subunit 1, mitochondrial
    • D3S3191
    • mitochondrial
    • OTTHUMP00000164820
    • QCR1
    • QCR1_HUMAN
    • Ubiquinol cytochrome c reductase complex core protein 1
    • ubiquinol-cytochrome c reductase core protein I
    • Ubiquinol-cytochrome-c reductase complex core protein 1
    • UQCR1
    • Uqcrc1
    see all
  • Function

    This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
  • Sequence similarities

    Belongs to the peptidase M16 family. UQCRC1/QCR1 subfamily.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177632 (3 µg).

References

ab177632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up