Description

  • Product name

    Recombinant Human UQCRC2 protein (denatured)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSLKVAPKVKATAAPAGAPPQPQDLEFTKL PNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKG ASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTA PEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCP DYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGG LGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVL GAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQ ATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFL EEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGN LGHTPFVDEL
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      15 to 453
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human UQCRC2 protein

Specifications

Our Abpromise guarantee covers the use of ab134532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 12.01% Urea, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Complex III subunit 2
    • Core protein II
    • Cytochrome b c1 complex subunit 2 mitochondrial
    • Cytochrome b-c1 complex subunit 2
    • EC 1.10.2.2
    • MC3DN5
    • mitochondrial
    • QCR2
    • QCR2_HUMAN
    • Ubiquinol cytochrome c reductase complex core protein 2 mitochondrial
    • Ubiquinol cytochrome c reductase core protein II
    • Ubiquinol-cytochrome-c reductase complex core protein 2
    • UQCR2
    • Uqcrc2
    see all
  • Function

    This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.
  • Sequence similarities

    Belongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134532.

References

ab134532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up