Description

  • Product name

    Recombinant Human UQCRFS1/RISP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL SRESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDST KSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALA KIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQH DLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIR LGPAPLNLEVPTYEFTSDDMVIVG
    • Amino acids

      1 to 274
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as UQCRFS1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Complex III subunit 5
    • Complex III subunit IX
    • Cytochrome b c1 complex subunit Rieske mitochondrial
    • Cytochrome b-c1 complex subunit 11
    • Cytochrome b-c1 complex subunit 5
    • Cytochrome b6f complex iron sulfur subunit, chloroplastic
    • petC
    • PGR1
    • Plastohydroquinone:plastocyanin oxidoreductase iron sulfur protein
    • Proton gradient regulation protein 1
    • Rieske iron sulfur protein
    • Rieske iron-sulfur protein
    • RIP1
    • RIS1
    • RISP
    • Ubiquinol cytochrome C reductase rieske iron sulphur
    • Ubiquinol cytochrome c reductase Rieske iron-sulfur polypeptide 1
    • Ubiquinol-cytochrome c reductase 8 kDa protein
    • Ubiquinol-cytochrome c reductase iron-sulfur subunit
    • UCRI_HUMAN
    • UQCR5
    • UQCRFS1
    see all
  • Function

    Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
    The transit peptide of the Rieske protein seems to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.
  • Sequence similarities

    Contains 1 Rieske domain.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab159787 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up