Description

  • Product name

    Recombinant Human Urokinase protein
    See all Urokinase proteins and peptides
  • Biological activity

    ab92767 is fully complexable with Human PAI-1.
  • Expression system

    Insect cells
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human

Specifications

Our Abpromise guarantee covers the use of ab92767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Solubility: > 2 mg/mL ab92767 is fully complexable with Human PAI-1.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.00
    Constituents: 0.41% Sodium acetate, 0.0292% EDTA, 0.58% Sodium chloride

General Info

  • Alternative names

    • ATF
    • ATF uPA
    • BDPLT5
    • Plasminogen activator
    • Plasminogen activator urinary
    • Plasminogen activator urokinase
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • U-plasminogen activator
    • uPA
    • URK
    • UROK_HUMAN
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    • Urokinase type plasminogen activator precursor
    • Urokinase-type plasminogen activator chain B
    see all
  • Function

    Specifically cleave the zymogen plasminogen to form the active enzyme plasmin.
  • Tissue specificity

    Expressed in the prostate gland and prostate cancers.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 EGF-like domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab92767:
    Lane 1. 3ug ab92767 non reduced
    Lane 2. 3ug ab92767 + 12ug PAI-1 non reduced
    Lane 3. Prestained standard

References

ab92767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

The urokinase protein ab92767 is amino acids 21 – 431. The numbering refers to to the UniProt record P00749. Here is a link to the page. http://www.uniprot.org/uniprot/P00749

And here is the amino acid sequence.

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRG

KASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK

PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRH

RGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLI

LHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGK

ENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPL

VCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up