Overview

  • Product name

    Recombinant Human Urotensin II protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERA SLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLS HLLARIWKPYKKRETPDCFWKYCV
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 124

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PRO1068
    • U-II
    • UCN2
    • UII
    • Urotensin 2 preproprotein isoform a
    • Urotensin 2 preproprotein isoform b
    • Urotensin II
    • Urotensin-2
    • UTS2
    • UTS2_HUMAN
    • UTSII
    see all
  • Function

    Highly potent vasoconstrictor.
  • Tissue specificity

    Brain specific.
  • Sequence similarities

    Belongs to the urotensin-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132128 stained with Coomassie Blue.

References

ab132128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up