Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSMKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNV KYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQG AFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEA LLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRD EKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKA CDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLR HHGLEVVIKNDSN
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 310
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_009053.1)

Specifications

Our Abpromise guarantee covers the use of ab174393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • bHLHb11
    • Class B basic helix-loop-helix protein 11
    • FCHL
    • FCHL 1
    • FCHL1
    • HGNC:12593
    • HYPLIP 1
    • HYPLIP1
    • Major late transcription factor
    • Major late transcription factor 1
    • MLTF
    • MLTF I
    • MLTFI
    • Transcription factor USF-1
    • UEF
    • Upstream stimulatory factor 1
    • Upstream transcription factor 1
    • Upstream transcription factor 1, isoform CRA_a
    • USF
    • USF 1
    see all
  • Relevance
    USF1 is a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E box motifs. USF1 has been linked to familial combined hyperlipidemia (FCHL). Two transcript variants encoding distinct isoforms have been identified for this.
  • Cellular localization
    Nuclear

Images

  • SDS-PAGE analysis USF1 using 3 µg of ab174393 on a 15% gel.

References

ab174393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up