Overview

  • Product name

    Recombinant human USP10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDG QEYQRIEFGVDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKITP DGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKK KKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMP PSVTPRTCNSPQNSTDSVSDIVPDSPFPGALGSDTRTAGQPEGGPGADFG QSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATNG VELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSKP SSSSPVAYVETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLE NVTLIHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYSK VQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFEP TYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLHEEMLNLKKLLSPSNE KLTISNGPKNHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQTP ITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLV ARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLI KNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYT TDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDLL
    • Molecular weight

      88 kDa including tags
    • Amino acids

      2 to 798
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 23 pmol/min/µg.


    Assay Conditions:
    Reaction was performed in 50 mM Tris, pH 7.4, 1 mM DTT, 0.5 mM EDTA, 500 nM Ub-AMC, and ab198669 in a 50 µL volume. Reaction was incubated at 37°C for 15 min. and fluorescent signal was measured at excitation = 340 nm, emission = 460 nm.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    >= 60 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol, 0.05% DTT

    Contains 90 µg/mL DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Deubiquitinating enzyme 10
    • KIAA0190
    • MGC124997
    • MGC2621
    • Ubiquitin carboxyl terminal hydrolase 10
    • Ubiquitin carboxyl-terminal hydrolase 10
    • Ubiquitin specific peptidase 10
    • Ubiquitin specific processing protease 10
    • Ubiquitin specific protease 10
    • Ubiquitin thioesterase 10
    • Ubiquitin thiolesterase 10
    • Ubiquitin-specific-processing protease 10
    • UBP10_HUMAN
    • UBPO
    • USP 10
    • USP10
    see all
  • Function

    Hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. Acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Does not deubiquitinate MDM2. Deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the peptidase C19 family. USP10 subfamily.
  • Post-translational
    modifications

    Phosphorylated by ATM following DNA damage, leading to stablization and translocation it to the nucleus.
  • Cellular localization

    Cytoplasm. Nucleus. Early endosome. Cytoplasmic in normal conditions. After DNA damage, translocates to the nucleus following phosphorylation by ATM.
  • Information by UniProt

Images

  • Example of specific activity of ab198669.

  • 10% SDS-PAGE with Coomassie staining: 3 µg ab198669.

References

ab198669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up