Description

  • Product name

    Recombinant Human USP11 protein
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAAN PAAAAAAVAAAAAVTEDREPQHEELPGLDSQWRQIENGESGRERPLRAGE SWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLV EGEDYVLLPAAAWHYLVSWYGLEHGQPPIE RKVIELPNIQKVEVYPVE LLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSE GSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEE DEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNF RNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQ HDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHKR RNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPISHKRVLEV FFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERMMVADVFSH RFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERT PARDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNS DDEDDGDEKEDDEEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLL DNCLGTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEVHAQPYIAIDWE PEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVRLQECIELFTTVETLEKEN PWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREKLDTLVEFP IRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDS GQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPAS PACSSPPSSEFMDVN
    • Predicted molecular weight

      110 kDa
    • Amino acids

      1 to 963
    • Additional sequence information

      NM_004651.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab206019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 10% Glycerol, 0.02% Beta mercaptoethanol, 0.24% Tris, 0.87% Sodium chloride

General Info

  • Alternative names

    • Deubiquitinating enzyme 11
    • Ubiquitin carboxyl-terminal hydrolase 11
    • Ubiquitin carboxyl-terminal hydrolase X linked
    • ubiquitin specific peptidase 11
    • Ubiquitin specific protease 11
    • Ubiquitin thiolesterase 11
    • Ubiquitin-specific-processing protease 11
    • UBP11_HUMAN
    • UHX1
    • USP11
    see all
  • Function

    Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 1 DUSP domain.
  • Cellular localization

    Nucleus. Cytoplasm. Predominantly nuclear. Associates with chromatin.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab206019 (5 µg).

References

ab206019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up