Description

  • Product name

    Recombinant human USP14/TGT protein
    See all USP14/TGT proteins and peptides
  • Biological activity

    Specific Activity: 56 pmol/min/µg.

    Assay Conditions: Reaction was performed in 50 mM Tris, pH 7.4, 1 mM DTT, 0.5 mM EDTA, 500 nM Ub-AMC, and USP14 in a 50 µL reaction. Reaction was incubated at 37°C for 15 min. and fluorescent signal was measured at excitation = 340 nm, emission = 460 nm.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGG TLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAM ELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQY ITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDAN ECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEF ETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQ SPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPL MLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKY EPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFD DDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      2 to 494
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      NM_005151.

Specifications

Our Abpromise guarantee covers the use of ab198432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as USP14

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

    90 µg/ml DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Deubiquitinating enzyme 14
    • TGT
    • tRNA guanine transglycosylase
    • tRNA guanine transglycosylase 60 kD subunit
    • Ubiquitin carboxyl terminal hydrolase 14
    • Ubiquitin carboxyl-terminal hydrolase 14
    • Ubiquitin specific peptidase 14
    • Ubiquitin specific processing protease 14
    • Ubiquitin specific protease 14
    • Ubiquitin thiolesterase 14
    • Ubiquitin-specific-processing protease 14
    • UBP14_HUMAN
    • USP 14
    • USP14
    see all
  • Function

    Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).
  • Sequence similarities

    Belongs to the peptidase C19 family. USP14/UBP6 subfamily.
    Contains 1 ubiquitin-like domain.
  • Cellular localization

    Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • 10% SDS-PAGE Coomassie staining using 2.8 µg ab198432 (Lane 1). Lane 2: Protein Marker

  • Activity assay using ab198432.

References

ab198432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up