Description

  • Product name

    Recombinant Human USP14/TGT protein (Tagged)
    See all USP14/TGT proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKG GTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASA MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQ YITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDA NECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVE FETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVK YEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKF DDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
    • Predicted molecular weight

      56 kDa
    • Amino acids

      1 to 494
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab206158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as USP14

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 10% Glycerol, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol

General Info

  • Alternative names

    • Deubiquitinating enzyme 14
    • TGT
    • tRNA guanine transglycosylase
    • tRNA guanine transglycosylase 60 kD subunit
    • Ubiquitin carboxyl terminal hydrolase 14
    • Ubiquitin carboxyl-terminal hydrolase 14
    • Ubiquitin specific peptidase 14
    • Ubiquitin specific processing protease 14
    • Ubiquitin specific protease 14
    • Ubiquitin thiolesterase 14
    • Ubiquitin-specific-processing protease 14
    • UBP14_HUMAN
    • USP 14
    • USP14
    see all
  • Function

    Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).
  • Sequence similarities

    Belongs to the peptidase C19 family. USP14/UBP6 subfamily.
    Contains 1 ubiquitin-like domain.
  • Cellular localization

    Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • Coomassie stained SDS PAGE of ab206158 (5 μg)

References

ab206158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up