Description

  • Product name

    Recombinant Human USP25 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELA VAFLTAKNAKTPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKD DLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAENKACLKRTPTE VWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNY KPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYVDPSRAVEILK DAFKSNDSQQEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQ NNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGL IIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKL TDFLPKLLDCSMEIKSFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 450

Specifications

Our Abpromise guarantee covers the use of ab131968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deubiquitinating enzyme 25
    • Ubiquitin carboxyl-terminal hydrolase 25
    • Ubiquitin specific peptidase 25
    • ubiquitin specific protease 25
    • ubiquitin specific protease USP25
    • Ubiquitin thiolesterase 25
    • Ubiquitin-specific-processing protease 25
    • UBP25_HUMAN
    • USP on chromosome 21
    • USP21
    • USP25
    see all
  • Function

    Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions to process newly synthesized Ubiquitin, to recycle ubiquitin molecules or to edit polyubiquitin chains and prevents proteasomal degradation of substrates. Hydrolyzes both 'Lys-48'- and 'Lys-63'-linked tetraubiquitin chains.
    The muscle-specific isoform (USP25m) may have a role in the regulation of muscular differentiation and function.
  • Tissue specificity

    Isoform USB25a is found in most adult and fetal tissues; expression is moderately high in testis, pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, but very low in peripheral blood, colon, small intestine, ovary, prostate, thymus and spleen. Isoform USB25b is found in all tissues except heart and skeletal muscle. Isoform USB25m is heart and skeletal muscle specific.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 1 UBA-like domain.
    Contains 2 UIM (ubiquitin-interacting motif) repeats.
  • Post-translational
    modifications

    Acetylated.
    Sumoylation impairs binding to and hydrolysis of ubiquitin chains. Sumoylated preferentially by SUMO2 or SUMO3. Desumoylated by SENP1. Regulated by ubiquitination on the same residue.
    Preferentially monoubiquitinated but can also be polyubiquitinated. Autodeubiquitinated. Ubiquitination activates the enzymatic activity either by preventing sumoylation or by allowing novel interactions.
    Phosphorylation in the C-terminal by SYK regulates USP25 cellular levels.
  • Cellular localization

    Cytoplasm and Cytoplasm. Nucleus. Some transient punctuate nuclear location in myotubes during myocyte development.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab131968 at approximately 75.24 kDa.

References

ab131968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up