Overview

  • Product name

    Recombinant Human USP30 protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRS PPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQ SQECKSEE
    • Amino acids

      401 to 508
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deubiquitinating enzyme 30
    • FLJ40511
    • Ub-specific protease 30
    • Ubiquitin carboxyl terminal hydrolase 30
    • Ubiquitin carboxyl-terminal hydrolase 30
    • Ubiquitin specific peptidase 30
    • Ubiquitin specific processing protease 30
    • Ubiquitin thioesterase 30
    • Ubiquitin thiolesterase 30
    • Ubiquitin-specific-processing protease 30
    • UBP30_HUMAN
    • usp30
    see all
  • Function

    May participate in the maintenance of mitochondrial morphology.
  • Tissue specificity

    Expressed in skeletal muscle, pancreas, liver and kidney.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab164653 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164653 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up