Overview

  • Product name

    Recombinant Human USP34 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDP EVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
    • Amino acids

      3296 to 3395
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deubiquitinating enzyme 34
    • FLJ43910
    • KIAA0570
    • KIAA0729
    • MGC104459
    • Ubiquitin carboxyl terminal hydrolase 34
    • Ubiquitin carboxyl-terminal hydrolase 34
    • Ubiquitin specific processing protease 34
    • Ubiquitin specific protease 34
    • Ubiquitin thioesterase 34
    • Ubiquitin thiolesterase 34
    • Ubiquitin-specific-processing protease 34
    • UBP34_HUMAN
    • USP 34
    • Usp34
    see all
  • Function

    Ubiquitin hydrolase that can remove conjugated ubiquitin from AXIN1 and AXIN2, thereby acting as a regulator of Wnt signaling pathway. Acts as an activator of the Wnt signaling pathway downstream of the beta-catenin destruction complex by deubiquitinating and stabilizing AXIN1 and AXIN2, leading to promote nuclear accumulation of AXIN1 and AXIN2 and positively regulate beta-catenin (CTNBB1)-mediated transcription. Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins.
  • Tissue specificity

    Expressed in brain at low level.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab160632 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up